Cobidoc

 
COBIDOC BV
Vanenburgerallee 14
3882 RH PUTTEN

T 088 688 03 33
F 088 688 03 00

Nieuws

Terug

28 November 2018Cobidoc Nieuwsbrief November 2018

 

COBIDOC NIEUWSBRIEF NOVEMBER 2018
IN DIT NIEUWSBERICHT
Updates in de RAPRA database continueren

Een aantal maanden geleden stopte de productie van de database RAPRA. De database is nu overgenomen door WTI-Frankfurt en gaat verder met het indexeren. De data van juni 2018 tot nu (november) worden aangevuld en updates zullen met de normale frequentie weer volgen.

Wanneer u SDI's in de tussentijd nog niet hebt verwijderd dan zult u automatisch weer resultaten ontvangen. De eerste alert die u ontvangt dekt de periode tussen Juni 2018 en nu.

WTI-Frankfurt verhoogd het aantal geïndexeerde documenten significant en is van plan om het "classification system of Polymer Library" toe te passen.

Tijdelijk worden de WTI classificatie toegepast. WTI-Classification.pdf

Indien u oude SDI's (alerts) wilt herstellen, of nieuwe automatische profielen wilt opstellen, neem dan gerust contact op met de Cobidoc Helpdesk via e-mail of telefoon 088-6880333, wij zijn u graag van dienst.

top

Ontmoet ons op de Chains conferentie

Vanaf maandag 3 tot woensdag 5 december staan wij met een stand op de Chains conferentie. Kom gerust bij ons langs voor vragen of een demonstratie.

top

SciFindern: Less search. More research.

Sequence upload in STNext

In STNext is de functie om grotere sequenties (DNA, RNA, eiwitten) te uploaden geactiveerd. In het "Structure" menu vindt u een knop om tekstbestanden te uploaden (zie screenshot hieronder). Al uw uploads blijven bewaard op uw loginID, net als alle chemische structuren die u tekent.


=>
Uploading sequence file: Sequence


UPLOAD SUCCESSFULLY COMPLETED
L1 GENERATED



=> RUN BLAST L1/SQP


BLAST Version 2.2.20

The BLAST software is used herein with permission of the
National Center for Biotechnology Information (NCBI) of
the National Library of Medicine (NLM). See also, Altschul,
Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui
Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein
database search programs." Nucleic Acids Res. 25:3389-3402

Database PCTGEN /data/blastdb/PC1_AA
Posted date: Nov 22, 2018 7:29 PM
Lambda K H
0.321 0.140 0.451
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 617,679,251
Number of Sequences: 3898672
Number of extensions: 26864160
Number of successful extensions: 66772
Number of sequences better than 10.0: 157
Number of HSP's better than 10.0 without gapping: 86
Number of HSP's successfully gapped in prelim test: 71
Number of HSP's that attempted gapping in prelim test: 66339
Number of HSP's gapped (non-prelim): 190
length of query: 347
length of database: 776,474,396
effective HSP length: 124
effective length of query: 223
effective length of database: 293,039,068
effective search space: 65347712164
effective search space used: 65347712164
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 73 (32.7 bits)
Total Execution Time: 4.39415

157 ANSWERS FOUND BELOW EXPECTATION VALUE OF 10.0

QUERY SELF SCORE VALUE IS 731
BEST ANSWER SCORE VALUE IS 731

Similarity
Score
731 ||
||
||
|||
|||
|||
|||
|||
|||
||||
366 ||||
||||
||||
|||||
|||||
||||||
||||||||||
|||||||||||||||||
|||||||||||||||||||||||||||
||||||||||||||||||||||||||||||||||||||||
Answer Count 40 80 120 160 200

ENTER EITHER THE NUMBER OF ANSWERS YOU WISH TO KEEP
OR ENTER MINIMUM PERCENT OF SELF SCORE FOLLOWED BY %
(BEST ANSWER PERCENTAGE OF SELF SCORE IS 100%)
ENTER (ALL) OR ? :70%

L2 RUN STATEMENT CREATED
L2 12 MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAG
LWQPYLSDPNNPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHE
AIPDPSWKDTVLGFRKLTPRELDMFPDYGYGWFHTSLILEGKNYLQWLTE
RLTERGVKFFQRKVESFEEVAREGADVIVNCTGVWAGALQRDPLLQPGRG
QIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGGIFQLGNWSEL
NNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL/SQ
P. -E 10.0

Answer set arranged by accession number; to sort by descending
similarity score, enter at an arrow prompt (=>) "sor score d".

=> D ALIGN 9

L2 ANSWER 9 OF 12 PCTGEN COPYRIGHT 2018 WIPO on STN
BLASTALIGN

Query = 347 letters
Length = 347
Score = 635 bits (1638), Expect = 0.0
Identities = 294/347 (84%), Positives = 321/347 (92%)
Query: 1 MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
MRVVVIGAGVIGLSTALCIHERYHSVLQPLD+KVYADRFTP TTTDVAAGLWQPY S+P+
Sbjct: 1 MRVVVIGAGVIGLSTALCIHERYHSVLQPLDVKVYADRFTPFTTTDVAAGLWQPYTSEPS
Query: 61 NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
NPQEA+W+QQTF+YLLSH+ SPNA N+GL +SGYNLF EA+PDP WKD VLGFRKLTPR
Sbjct: 61 NPQEANWNQQTFNYLLSHIGSPNAANMGLTPVSGYNLFREAVPDPYWKDMVLGFRKLTPR
Query: 121 ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
ELDMFPDY YGWF+TSLILEG+ YLQWLTERLTERGVKFF RKVESFEEVAR GADVI+N
Sbjct: 121 ELDMFPDYRYGWFNTSLILEGRKYLQWLTERLTERGVKFFLRKVESFEEVARGGADVIIN
Query: 181 CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
CTGVWAG LQ DPLLQPGRGQI+KVDAPW+K+FI+THD ERGIYNSPYIIPG Q VTLGG
Sbjct: 181 CTGVWAGVLQPDPLLQPGRGQIIKVDAPWLKNFIITHDLERGIYNSPYIIPGLQAVTLGG
Query: 241 IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
FQ+GNW+E+NNIQDHNTIWEGCCRLEPTLK+A+I+GE TGFRPVRPQ+RLEREQLR G
Sbjct: 241 TFQVGNWNEINNIQDHNTIWEGCCRLEPTLKDAKIVGEYTGFRPVRPQVRLEREQLRFGS
Query: 301 SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL 347
SNTEVIHNYGHGGYGLTIHWGCALE AKLFG++LEE+ L MPPSHL
Sbjct: 301 SNTEVIHNYGHGGYGLTIHWGCALEVAKLFGKVLEERNLLTMPPSHL 347

 

top

NCI Global inloggen met username

Sinds 1 november is het mogelijk om uw IP autorisatie voor NCI Global om te zetten naar een username en password login. Op deze manier heeft u vanaf elke locatie in de wereld toegang tot regulatory information.

top

Derwent Markush Resource beschikbaar in STNext

De Derwent Markush Resource (DWPIM) is nu beschikbaar in STNext™. DWPIM is een structure database met 2.1 miljoen Markush structures uit 890,000 Derwent World Patents Index® (DWPI) documenten. DWPIM bevat vele functionaliteiten zodat u efficiënt kunt zoeken:

  • Markush structure sample searching en batch mode searching (offline)
  • Verplaats eenvoudig resultaten over naar Derwent World Patents Index® (files WPINDEX, WPIDS, WPIX)
  • Verschillende structure display opties in DWPIM en WPINDEX, WPIDS, WPIX, waaronder hit structure highlighting
  • SDI's (automatische STN profielen)
  • 22 verschillende generic nodes kunnen gebruikt worden in de Structure Editor (inclusief Derwent superatoms). Zie de screenshot hieronder.

 

top

Cursusschema 2019

Hieronder vindt u het cursusoverzicht voor 2019. Via de links kunt u zich direct inschrijven. Indien u zich inschrijft voor een WebEx sturen wij u minimaal twee dagen van te voren een WebEx uitnodiging. Trainingen die langer dan één uur duren vinden plaats in ons kantoor in Putten. Voor meer informatie verwijzen wij u naar onze website: www.cobidoc.nl/cursussen

08-janWebEx: Writing scripts in STNextWebEx
10-janWebEx: Using substance roles on STNextWebEx
15-janWebEx: Sequence Blast Searching on STNextWebEx
17-janWebEx: SciFinder IntroductionWebEx
22-janSTNext Essentials trainingPutten
24-janWebEx: SciFinder-n IntroductionWebEx
29-janWebEx: A look into MethodsNow AnalyticsWebEx
31-janWebEx: A look into MethodsNow SyntheticWebEx
05-febIntroduction into the Derwent World Patent Index (DWPI)Putten
07-febWebEx: Patent Monitoring with FIZ PatMonWebEx
13-febWebEx: Searching for natural products in SciFinderWebEx
08-mrtWebEx: PatentPak on SciFinder (20 min)WebEx
12-mrtCAS Contact DayT.B.A.
14-mrtWebEx: SciFinder-n IntroductionWebEx
19-mrtMarkush Searching in Marpat and DWPIMPutten
21-mrtWebEx: STNext Numeric Property Searching in Full-Text Patent FilesWebEx
26-mrtWebEx: Alerts on STNextWebEx
28-mrtWebEx: Improve Your Chemical Name Searches in STNextWebEx
02-aprWebEx: Polymer searching in SciFinder-nWebEx
04-aprWebEx: Sequence Motif Searching in STNextWebEx
09-aprWebEx: Polymer Searching in STNextPutten
11-aprWebEx: SciFinder-n IntroductionWebEx
16-aprWebEx: STNext Citation searching WebEx
08-meiWebEx: NCI Global introduction (20 min)WebEx
09-meiWebEx: SciFinder-n IntroductionWebEx
14-meiWebEx: SciFinder IntroductionWebEx
22-meiPatent Family and Legal Status SearchingPutten
28-meiWebEx: SciFinder-n Structure Searching tipsWebEx
04-junAdvanced searching in STNextPutten
12-junStructure searching in multiple databases on STNextPutten
18-junSTNext Essentials trainingPutten
20-junWebEx: A look into MethodsNow SyntheticWebEx
25-junWebEx: SciFinder-n IntroductionWebEx
02-julWriting scripts in STNextPutten
03-sepWebEx: SciFinder-n IntroductionWebEx
05-sepWebEx: A look into MethodsNow AnalyticsWebEx
11-sepWebEx: Toxicology searching on STNextWebEx
12-sepSTNext Essentials trainingPutten
19-sepIntroduction into the Derwent World Patent Index (DWPI)Putten
24-sepWebEx: Using thesauri on STNextWebEx
25-sepStructure searching in multiple databasesPutten
30-sepWebEx: STNext Numeric Property Searching in Full-Text Patent FilesWebEx
04-oktWebEx: Using substance roles on STNextWebEx
08-oktWebEx: patent Monitoring with FIZ PatMonWebEx
11-oktWebEx: SciFinder-n IntroductionWebEx
30-oktAdvanced searching in STNextPutten
31-oktWebEx: Tips 'n tricks in Structure Searching on STNext (advanced)WebEx
05-novWebEx: Alerts on STNextWebEx
07-novWebEx: STNext Citation searching WebEx
12-novWebEx: Structure Searching in SciFinder-nWebEx
14-novMarkush Searching in Marpat and DWPIMPutten
19-novWebEx: SciFinder IntroductionWebEx
21-novWebEx: NCI Global introduction (20 min)WebEx
26-novWebEx: SciFinder-n IntroductionWebEx
29-novWebEx: Sequence Motif Searching in STNextWebEx

top

Contact opnemen
Klik op één van de volgende links om uzelf, een collega of een andere geïnteresseerde aan te melden of af te melden voor deze nieuwsbrief. Heeft u een vraag? Neem dan gerust contact op met de Cobidoc Helpdesk via e-mail of telefoon 088-6880333, wij zijn u graag van dienst.