Cobidoc

 
COBIDOC BV
Vanenburgerallee 14
3882 RH PUTTEN

T 088 688 03 33
F 088 688 03 00

Nieuws

Terug

12 Februari 2010Cobidoc Nieuwsbrief Februari 2010

 

 

COBIDOC NIEUWSBRIEF FEBRUARI - 2010
Cobidoc BV: Specialist in chemische informatie, octrooi-informatie en Europese aanbestedingen
IN DIT NIEUWSBERICHT
STN Database Guide

Op de website van CAS is de STN Guide gelanceerd. Dit is een tool om eenvoudig databases te selecteren op basis van bijvoorbeeld:

  • Database onderwerp
  • Database-eigenschappen zoals
    • Gebruik van afkortingen
    • CAS Registry nummers
    • SLART
    • Thesauri
  • Clusters
  • Product (STN AnaVist, Viewer, Easy)

U vindt de tool hier.

Na de selectie kunt u de summary sheets van de betreffende databases bekijken voor meer gedetaileerde informatie.

Ook is het nu mogelijk om alle summarysheets in een keer te downloaden. U vindt alle summary sheets in een zip-file op de volgende locatie: http://stnguide.cas.org/pdf/summary_sheets.zip.

top

SciFinder® .sfr to .akx File Conversion Tool

SciFinder heeft een tool gelanceerd om uw oude .SFR (Client software) bestanden om te zetten naar .AKX (SciFinder on the Web). De tool kunt u hier vinden. Het enige wat u nodig hebt is een SciFinder loginID en de bestanden die u wilt omzetten voor het web.

Het is ook mogelijk om meerdere bestanden in een keer om te zetten door deze gezamelijk te "zippen". Meer informatie daarover vindt u hier.

top

Database nieuws

INPADOCDB / INPAFAMDB

The cited patent information has been enhanced with patent assignee names ofthe cited patent numbers. These new cited patent assignee names (/PAS.D) areavailable now available for search, too.

Two new SELECT fields are available. The field PRCF identifies the country ofof the first priority, the field PRCF.WO can be used to identify the countrywhere a first PCT priority was filed.

INSPEC

Following swiftly on from the addition of the10 millionth record last year, 2009 has seen a double celebration for Inspec® - its 40th anniversary and the upload of the 11 millionth record.

Established in 1969, Inspec® celebrated 40 years of innovative approaches to engineering and scientific research in 2009. It is the leading multi-disciplinary database covering the significant research and development literature in the fields of physics, electronics, communications, electrical engineering, control engineering, information technology, and the applications of computers to a wide variety of disciplines.

The database continues to grow with abstracts to over 4,000 journal titles, 2,700 conference proceedings, numerous books, technical reports, and dissertations added annually. In total around 700,000 records are added annually.

USGENE, PCTGEN new FASTA display

As of February 01 2010, the new sequence display formats FASTA and FASTA2 will be added to the sequence databases USGENE and PCTGEN. These FASTA display formats are widely accepted by 3rd party sequence analysis tools, so that sequence search results from USGENE and PCTGEN can directly be used for further analysis.

The new format FASTA comprises a header line providing a unique description of the sequence (accession number, sequence identity number and patent publication number) and the actual sequence in lines of 70 characters. FASTA2 is a lower-priced alternative format which provides the same sequence information with a truncated header line.

FASTA and FASTA2 can be used in combination with the standard display formats ALL and BRIEF generating no additional costs.

Example of FASTA- and FASTA2-format:

=> D FASTA

FASTA:
>USGENE|20100017904.32958|Protein|sequence 32958 from US20100017904
mgevvatweateggagvkgpvvvtgasgflgswlvmkllqagytvratvrdpanvvktkplldlpgater
lslwkadladegsfddairgctgvfhvatpmdfeskdpenevikptvegmmsimrackeagtvrrivfts
sagtvnieerqrpvydqdnwsdvdfcqrvkmtgwmyfvskslaekaamayaaehgldfisiiptlvvgpf
lsagmppslitalalvtgneahysilkqvqfvhlddlcdahlflfehpaaagryvcsshdatihglaaml
rdrypeydiperfpgieddlqpvhfsskklldhgftfkytvedmfdaairmcrekgliplatagggralp

=> D FASTA2

FASTA2:
>USGENE|Protein
mgevvatweateggagvkgpvvvtgasgflgswlvmkllqagytvratvrdpanvvktkplldlpgater
lslwkadladegsfddairgctgvfhvatpmdfeskdpenevikptvegmmsimrackeagtvrrivfts
sagtvnieerqrpvydqdnwsdvdfcqrvkmtgwmyfvskslaekaamayaaehgldfisiiptlvvgpf
lsagmppslitalalvtgneahysilkqvqfvhlddlcdahlflfehpaaagryvcsshdatihglaaml
rdrypeydiperfpgieddlqpvhfsskklldhgftfkytvedmfdaairmcrekgliplatagggralp

top

 
Gespecialiseerde cursussen
DatumTijdCursus
22 Feb 201010:00 - 14:00Analysis and Visualization with STN AnaVist

top

Cursusschema

Hieronder vindt u het cursusoverzicht voor 2010. Voor meer informatie verwijzen wij u naar onze website: www.cobidoc.nl of klik op de links hieronder om u direct in te schrijven.

DatumTijdCursus
18 Feb 201010:00 - 14:00STN Intermediate
9 Mrt 201010:00 - 16:00STN Basics
16 Mrt 201010:00 - 14:00STN Intermediate
23 Mrt 201010:00 - 14:00SciFinder Basics
14 Apr 201010:00 - 16:00STN Basics
21 Apr 201010:00 - 14:00STN intermediate
28 Apr 201010:00 - 14:00SciFinder Basics
12 Mei 201010:00 - 14:00SciFinder Basics
18 Mei 201010:00 - 16:00STN Basics
25 Mei 201010:00 - 14:00STN Intermediate
8 Jun 201010:00 - 14:00SciFinder Basics
17 Jun 201010:00 - 16:00STN Basics
24 Jun 201010:00 - 14:00STN Intermediate
29 Jun 201010:00 - 14:00SciFinder Basics
6 Sep 201010:00 - 16:00STN Basics
8 Sep 201010:00 - 14:00SciFinder Basics
23 Sep 201010:00 - 14:00STN Intermediate
6 Okt 201010:00 - 10:00STN Basics
12 Okt 201010:00 - 14:00SciFinder Basics
14 Okt 201010:00 - 14:00STN Intermediate
8 Nov 201010:00 - 14:00SciFinder Basics
16 Nov 201010:00 - 16:00STN Basics
23 Nov 201010:00 - 14:00STN Intermediate

De meer gespecialiseerde cursussen, worden op aanvraag georganiseerd. U hoeft dan bijvoorbeeld niet meer enkele maanden te wachten totdat de cursus weer aan de beurt is. U kunt een datum afspreken, die u het beste uit komt. Neemt u hiervoor contact op met de Cobidoc helpdesk (020-6880333 of helpdesk@cobidoc.nl). Een overzicht van de gespecialiseerde cursussen vindt u hieronder.

Advanced Structure Searching in CAS REGISTRYIntroduction to DWPI
Advanced Subject Searching in CAPLUSIntroduction to INPADOCDB + INPAFAMDB
Advanced Text Searching in the CAS REGISTRY FileMarkush Searching in the Patent Literature
Analysis and Visualization with STN AnaVistMEDLINE Medical Subject Headings (MeSH)
Basic Patent SearchingPatent Family and Legal Status Searching
Basic Subject Searching in CAPLUSPolymer Searching
Basic Substance SearchingProperty Searching in CAS REGISTRY
BEILSTEINReaction Searching in CASREACT
Biotechnology Searching on STNSearching Full-Text Patent Files + STN Viewer
CAS RolesSequence Searching
Citation SearchingStructure Searching in the CAS REGISTRY File
Dealing with Large Answer SetsThe Virtual File

top

Contactopnemen
Klik op een van de volgende links om u zelf, eencollega of een andere geïnteresseerde aan te melden of af te melden voor deze nieuwsbrief. Heeft u een vraag? Neem dangerust contact op met de Cobidoc Helpdesk via e-mail of detelefoon 020-6880333, wij zijn u graag van dienst.