|
| | | COBIDOC BV
J.P. Coengebouw
Kabelweg 37
Amsterdam
T 020 688 03 33
F 020 681 86 26 |
| NieuwsTerug
| 12 February 2010 |
Cobidoc Nieuwsbrief Februari 2010 |
|
| COBIDOC NIEUWSBRIEF FEBRUARI - 2010 |  | | IN DIT NIEUWSBERICHT | | | STN Database Guide | Op de website van CAS is de STN Guide gelanceerd. Dit is een tool om eenvoudig databases te selecteren op basis van bijvoorbeeld: - Database onderwerp
- Database-eigenschappen zoals
- Gebruik van afkortingen
- CAS Registry nummers
- SLART
- Thesauri
- Clusters
- Product (STN AnaVist, Viewer, Easy)
U vindt de tool hier. Na de selectie kunt u de summary sheets van de betreffende databases bekijken voor meer gedetaileerde informatie. Ook is het nu mogelijk om alle summarysheets in een keer te downloaden. U vindt alle summary sheets in een zip-file op de volgende locatie: http://stnguide.cas.org/pdf/summary_sheets.zip. top
| | SciFinder® .sfr to .akx File Conversion Tool | SciFinder heeft een tool gelanceerd om uw oude .SFR (Client software) bestanden om te zetten naar .AKX (SciFinder on the Web). De tool kunt u hier vinden. Het enige wat u nodig hebt is een SciFinder loginID en de bestanden die u wilt omzetten voor het web. Het is ook mogelijk om meerdere bestanden in een keer om te zetten door deze gezamelijk te "zippen". Meer informatie daarover vindt u hier. top
| | Database nieuws | INPADOCDB / INPAFAMDB The cited patent information has been enhanced with patent assignee names ofthe cited patent numbers. These new cited patent assignee names (/PAS.D) areavailable now available for search, too. Two new SELECT fields are available. The field PRCF identifies the country ofof the first priority, the field PRCF.WO can be used to identify the countrywhere a first PCT priority was filed.
INSPEC Following swiftly on from the addition of the10 millionth record last year, 2009 has seen a double celebration for Inspec® - its 40th anniversary and the upload of the 11 millionth record. Established in 1969, Inspec® celebrated 40 years of innovative approaches to engineering and scientific research in 2009. It is the leading multi-disciplinary database covering the significant research and development literature in the fields of physics, electronics, communications, electrical engineering, control engineering, information technology, and the applications of computers to a wide variety of disciplines. The database continues to grow with abstracts to over 4,000 journal titles, 2,700 conference proceedings, numerous books, technical reports, and dissertations added annually. In total around 700,000 records are added annually.
USGENE, PCTGEN new FASTA display As of February 01 2010, the new sequence display formats FASTA and FASTA2 will be added to the sequence databases USGENE and PCTGEN. These FASTA display formats are widely accepted by 3rd party sequence analysis tools, so that sequence search results from USGENE and PCTGEN can directly be used for further analysis. The new format FASTA comprises a header line providing a unique description of the sequence (accession number, sequence identity number and patent publication number) and the actual sequence in lines of 70 characters. FASTA2 is a lower-priced alternative format which provides the same sequence information with a truncated header line. FASTA and FASTA2 can be used in combination with the standard display formats ALL and BRIEF generating no additional costs. Example of FASTA- and FASTA2-format: => D FASTA FASTA:
>USGENE|20100017904.32958|Protein|sequence 32958 from US20100017904
mgevvatweateggagvkgpvvvtgasgflgswlvmkllqagytvratvrdpanvvktkplldlpgater
lslwkadladegsfddairgctgvfhvatpmdfeskdpenevikptvegmmsimrackeagtvrrivfts
sagtvnieerqrpvydqdnwsdvdfcqrvkmtgwmyfvskslaekaamayaaehgldfisiiptlvvgpf
lsagmppslitalalvtgneahysilkqvqfvhlddlcdahlflfehpaaagryvcsshdatihglaaml
rdrypeydiperfpgieddlqpvhfsskklldhgftfkytvedmfdaairmcrekgliplatagggralp => D FASTA2 FASTA2:
>USGENE|Protein
mgevvatweateggagvkgpvvvtgasgflgswlvmkllqagytvratvrdpanvvktkplldlpgater
lslwkadladegsfddairgctgvfhvatpmdfeskdpenevikptvegmmsimrackeagtvrrivfts
sagtvnieerqrpvydqdnwsdvdfcqrvkmtgwmyfvskslaekaamayaaehgldfisiiptlvvgpf
lsagmppslitalalvtgneahysilkqvqfvhlddlcdahlflfehpaaagryvcsshdatihglaaml
rdrypeydiperfpgieddlqpvhfsskklldhgftfkytvedmfdaairmcrekgliplatagggralp
top | | Gespecialiseerde cursussen | top | | Cursusschema | Hieronder vindt u het cursusoverzicht voor 2010. Voor meer informatie verwijzen wij u naar onze website: www.cobidoc.nl of klik op de links hieronder om u direct in te schrijven. De meer gespecialiseerde cursussen, worden op aanvraag georganiseerd. U hoeft dan bijvoorbeeld niet meer enkele maanden te wachten totdat de cursus weer aan de beurt is. U kunt een datum afspreken, die u het beste uit komt. Neemt u hiervoor contact op met de Cobidoc helpdesk (020-6880333 of helpdesk@cobidoc.nl). Een overzicht van de gespecialiseerde cursussen vindt u hieronder.
top
| | Contactopnemen | Klik op een van de volgende links om u zelf, eencollega of een andere geïnteresseerde aan te melden of af te melden voor deze nieuwsbrief. Heeft u een vraag? Neem dangerust contact op met de Cobidoc Helpdesk via e-mail of detelefoon 020-6880333, wij zijn u graag van dienst. |
| |
|
|
|
|
| |
|
|
